ABIN631997

antibody from antibodies-online

Targeting: SPAG6 CFAP194, CT141, FAP194, PF16, Repro-SA-1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631997 - Provider product page
Provider: antibodies-online
Product name: anti-Sperm Associated Antigen 6 (SPAG6) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: SPAG6 antibody was raised using the middle region of SPAG6 corresponding to a region with amino acids HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

SPAG6 protein structure - ABIN631997 shown in red.