H00009576-M05

SPAG6 antibody from Abnova Corporation
CT141, pf16, Repro-SA-1

Antibody data

Product number
H00009576-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009576-M05, RRID:AB_1137047
Product name
SPAG6 monoclonal antibody (M05), clone 2F3
Provider product page
Abnova Corporation - H00009576-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SPAG6.
Antigen sequence
MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIE
TLQNAGVMSLLRTLLLDVVPTIQQIAALALGRLAN
YNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAF
VLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPG
VKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLC
IQEPEIALKGIAASALSDIVKHSPELAQTVVDAGA
VAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAE
MVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAK
HTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIM
MLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPED
HIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLS
LYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPF
LYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQL
STT
Isotype
IgG
Antibody clone number
2F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -