HPA012882

SCRG1 antibody from Sigma-Aldrich
SCRG-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012882
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012882, RRID:AB_1856635
Product name
Anti-SCRG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012882
Antibody type
Polyclonal
Antigen
Scrapie-responsive protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMI
CYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Storage
-20C
Provider Type Product Number
- No reagents -