H00050846-M04

DHH antibody from Abnova Corporation
HHG-3, MGC35145
No application information provided.

Antibody data

Product number
H00050846-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00050846-M04, RRID:AB_1137169
Product name
DHH monoclonal antibody (M04), clone 2G10
Provider product page
Abnova Corporation - H00050846-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DHH.
Antigen sequence
SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLD
RDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGP
APAPGDFAPVFARRLRAGDSVLAPGGDALRP*
Isotype
IgG
Antibody clone number
2G10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -