Antibody data
- Antibody Data
- Antigen structure
- References [21]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006786-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006786-M01, RRID:AB_607105
- Product name
- STIM1 monoclonal antibody (M01), clone 5A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant STIM1.
- Antigen sequence
SHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHS
EDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLR
EDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSE
VYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHA
MPRLAVTNTTMTGAVLKMTDRSHRQKLQLKALDTV
LFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQ
NRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKA
QEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKEL
REGTENERSRQKYAEEELEQVREALRKAEKELESH
SSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQL
LVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHK
ILTAKQALSEVTAALRERLHRWQQIEILCGFQIVN
NPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVD
DMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQ
RDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEAL
NAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKAL
LALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHS
PSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAV
AEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK- Isotype
- IgG
- Antibody clone number
- 5A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references BAX inhibitor-1 is a Ca(2+) channel critically important for immune cell function and survival.
IL-9 induces IL-8 production via STIM1 activation and ERK phosphorylation in epidermal keratinocytes: A plausible mechanism of IL-9R in atopic dermatitis.
Identification of Stim1 as a candidate gene for exaggerated sympathetic response to stress in the stroke-prone spontaneously hypertensive rat.
Store-operated Ca2+ entry (SOCE) regulates melanoma proliferation and cell migration.
Lysophosphatidic acid promotes cell migration through STIM1- and Orai1-mediated Ca2+(i) mobilization and NFAT2 activation.
SGK3 regulates Ca(2+) entry and migration of dendritic cells.
Transcription factor NF-κB regulates expression of pore-forming Ca2+ channel unit, Orai1, and its activator, STIM1, to control Ca2+ entry and affect cellular functions.
Stromal interaction molecule 1 (STIM1) is involved in the regulation of mitochondrial shape and bioenergetics and plays a role in oxidative stress.
Intracellular cyclophilin A is an important Ca(2+) regulator in platelets and critically involved in arterial thrombus formation.
Identification of functional domains and novel binding partners of STIM proteins.
Store-operated calcium entry modulates neuronal network activity in a model of chronic epilepsy.
STIM1 as a key regulator for Ca2+ homeostasis in skeletal-muscle development and function.
Stromal interaction molecules 1 and 2 are key regulators of autoreactive T cell activation in murine autoimmune central nervous system inflammation.
Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1.
STIM1-independent T cell development and effector function in vivo.
STIM1 is essential for Fcgamma receptor activation and autoimmune inflammation.
Proteome-wide identification of novel binding partners to the oncogenic fusion gene protein, NPM-ALK, using tandem affinity purification and mass spectrometry.
STIM1 converts TRPC1 from a receptor-operated to a store-operated channel: moving TRPC1 in and out of lipid rafts.
Lipid rafts determine clustering of STIM1 in endoplasmic reticulum-plasma membrane junctions and regulation of store-operated Ca2+ entry (SOCE).
The calcium sensor STIM1 is an essential mediator of arterial thrombosis and ischemic brain infarction.
An EF hand mutation in Stim1 causes premature platelet activation and bleeding in mice.
Lisak D, Schacht T, Gawlitza A, Albrecht P, Aktas O, Koop B, Gliem M, Hofstetter HH, Zanger K, Bultynck G, Parys JB, De Smedt H, Kindler T, Adams-Quack P, Hahn M, Waisman A, Reed JC, Hövelmeyer N, Methner A
Cell death and differentiation 2016 Feb;23(2):358-68
Cell death and differentiation 2016 Feb;23(2):358-68
IL-9 induces IL-8 production via STIM1 activation and ERK phosphorylation in epidermal keratinocytes: A plausible mechanism of IL-9R in atopic dermatitis.
Hong CH, Chang KL, Wang HJ, Yu HS, Lee CH
Journal of dermatological science 2015 Jun;78(3):206-14
Journal of dermatological science 2015 Jun;78(3):206-14
Identification of Stim1 as a candidate gene for exaggerated sympathetic response to stress in the stroke-prone spontaneously hypertensive rat.
Ferdaus MZ, Xiao B, Ohara H, Nemoto K, Harada Y, Saar K, Hübner N, Isomura M, Nabika T
PloS one 2014;9(4):e95091
PloS one 2014;9(4):e95091
Store-operated Ca2+ entry (SOCE) regulates melanoma proliferation and cell migration.
Umemura M, Baljinnyam E, Feske S, De Lorenzo MS, Xie LH, Feng X, Oda K, Makino A, Fujita T, Yokoyama U, Iwatsubo M, Chen S, Goydos JS, Ishikawa Y, Iwatsubo K
PloS one 2014;9(2):e89292
PloS one 2014;9(2):e89292
Lysophosphatidic acid promotes cell migration through STIM1- and Orai1-mediated Ca2+(i) mobilization and NFAT2 activation.
Jans R, Mottram L, Johnson DL, Brown AM, Sikkink S, Ross K, Reynolds NJ
The Journal of investigative dermatology 2013 Mar;133(3):793-802
The Journal of investigative dermatology 2013 Mar;133(3):793-802
SGK3 regulates Ca(2+) entry and migration of dendritic cells.
Schmid E, Bhandaru M, Nurbaeva MK, Yang W, Szteyn K, Russo A, Leibrock C, Tyan L, Pearce D, Shumilina E, Lang F
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2012;30(6):1423-35
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2012;30(6):1423-35
Transcription factor NF-κB regulates expression of pore-forming Ca2+ channel unit, Orai1, and its activator, STIM1, to control Ca2+ entry and affect cellular functions.
Eylenstein A, Schmidt S, Gu S, Yang W, Schmid E, Schmidt EM, Alesutan I, Szteyn K, Regel I, Shumilina E, Lang F
The Journal of biological chemistry 2012 Jan 20;287(4):2719-30
The Journal of biological chemistry 2012 Jan 20;287(4):2719-30
Stromal interaction molecule 1 (STIM1) is involved in the regulation of mitochondrial shape and bioenergetics and plays a role in oxidative stress.
Henke N, Albrecht P, Pfeiffer A, Toutzaris D, Zanger K, Methner A
The Journal of biological chemistry 2012 Dec 7;287(50):42042-52
The Journal of biological chemistry 2012 Dec 7;287(50):42042-52
Intracellular cyclophilin A is an important Ca(2+) regulator in platelets and critically involved in arterial thrombus formation.
Elvers M, Herrmann A, Seizer P, Münzer P, Beck S, Schönberger T, Borst O, Martin-Romero FJ, Lang F, May AE, Gawaz M
Blood 2012 Aug 9;120(6):1317-26
Blood 2012 Aug 9;120(6):1317-26
Identification of functional domains and novel binding partners of STIM proteins.
Saitoh N, Oritani K, Saito K, Yokota T, Ichii M, Sudo T, Fujita N, Nakajima K, Okada M, Kanakura Y
Journal of cellular biochemistry 2011 Jan;112(1):147-56
Journal of cellular biochemistry 2011 Jan;112(1):147-56
Store-operated calcium entry modulates neuronal network activity in a model of chronic epilepsy.
Steinbeck JA, Henke N, Opatz J, Gruszczynska-Biegala J, Schneider L, Theiss S, Hamacher N, Steinfarz B, Golz S, Brüstle O, Kuznicki J, Methner A
Experimental neurology 2011 Dec;232(2):185-94
Experimental neurology 2011 Dec;232(2):185-94
STIM1 as a key regulator for Ca2+ homeostasis in skeletal-muscle development and function.
Kiviluoto S, Decuypere JP, De Smedt H, Missiaen L, Parys JB, Bultynck G
Skeletal muscle 2011 Apr 4;1(1):16
Skeletal muscle 2011 Apr 4;1(1):16
Stromal interaction molecules 1 and 2 are key regulators of autoreactive T cell activation in murine autoimmune central nervous system inflammation.
Schuhmann MK, Stegner D, Berna-Erro A, Bittner S, Braun A, Kleinschnitz C, Stoll G, Wiendl H, Meuth SG, Nieswandt B
Journal of immunology (Baltimore, Md. : 1950) 2010 Feb 1;184(3):1536-42
Journal of immunology (Baltimore, Md. : 1950) 2010 Feb 1;184(3):1536-42
Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1.
Pani B, Ong HL, Brazer SC, Liu X, Rauser K, Singh BB, Ambudkar IS
Proceedings of the National Academy of Sciences of the United States of America 2009 Nov 24;106(47):20087-92
Proceedings of the National Academy of Sciences of the United States of America 2009 Nov 24;106(47):20087-92
STIM1-independent T cell development and effector function in vivo.
Beyersdorf N, Braun A, Vögtle T, Varga-Szabo D, Galdos RR, Kissler S, Kerkau T, Nieswandt B
Journal of immunology (Baltimore, Md. : 1950) 2009 Mar 15;182(6):3390-7
Journal of immunology (Baltimore, Md. : 1950) 2009 Mar 15;182(6):3390-7
STIM1 is essential for Fcgamma receptor activation and autoimmune inflammation.
Braun A, Gessner JE, Varga-Szabo D, Syed SN, Konrad S, Stegner D, Vögtle T, Schmidt RE, Nieswandt B
Blood 2009 Jan 29;113(5):1097-104
Blood 2009 Jan 29;113(5):1097-104
Proteome-wide identification of novel binding partners to the oncogenic fusion gene protein, NPM-ALK, using tandem affinity purification and mass spectrometry.
Wu F, Wang P, Young LC, Lai R, Li L
The American journal of pathology 2009 Feb;174(2):361-70
The American journal of pathology 2009 Feb;174(2):361-70
STIM1 converts TRPC1 from a receptor-operated to a store-operated channel: moving TRPC1 in and out of lipid rafts.
Alicia S, Angélica Z, Carlos S, Alfonso S, Vaca L
Cell calcium 2008 Nov;44(5):479-91
Cell calcium 2008 Nov;44(5):479-91
Lipid rafts determine clustering of STIM1 in endoplasmic reticulum-plasma membrane junctions and regulation of store-operated Ca2+ entry (SOCE).
Pani B, Ong HL, Liu X, Rauser K, Ambudkar IS, Singh BB
The Journal of biological chemistry 2008 Jun 20;283(25):17333-40
The Journal of biological chemistry 2008 Jun 20;283(25):17333-40
The calcium sensor STIM1 is an essential mediator of arterial thrombosis and ischemic brain infarction.
Varga-Szabo D, Braun A, Kleinschnitz C, Bender M, Pleines I, Pham M, Renné T, Stoll G, Nieswandt B
The Journal of experimental medicine 2008 Jul 7;205(7):1583-91
The Journal of experimental medicine 2008 Jul 7;205(7):1583-91
An EF hand mutation in Stim1 causes premature platelet activation and bleeding in mice.
Grosse J, Braun A, Varga-Szabo D, Beyersdorf N, Schneider B, Zeitlmann L, Hanke P, Schropp P, Mühlstedt S, Zorn C, Huber M, Schmittwolf C, Jagla W, Yu P, Kerkau T, Schulze H, Nehls M, Nieswandt B
The Journal of clinical investigation 2007 Nov;117(11):3540-50
The Journal of clinical investigation 2007 Nov;117(11):3540-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STIM1 monoclonal antibody (M01), clone 5A2. Western Blot analysis of STIM1 expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STIM1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STIM1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to STIM1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol