HPA011088

STIM1 antibody from Sigma-Aldrich
D11S4896E, GOK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011088
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011088, RRID:AB_1849884
Product name
Anti-STIM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011088
Antibody type
Polyclonal
Antigen
Stromal interaction molecule 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNP
GIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRD
LTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNA
MTSNGSH
Storage
-20C
Provider Type Product Number
- No reagents -