HPA011155

LAIR1 antibody from Sigma-Aldrich
CD305
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011155
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011155, RRID:AB_1852685
Product name
Anti-LAIR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011155
Antibody type
Polyclonal
Antigen
Leukocyte-associated immunoglobulin-like receptor 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTA
DKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDH
WALTQRTARAVSPQSTKPMAESITYAAVARH
Storage
-20C
Provider Type Product Number
- No reagents -