Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010537-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010537-B01P, RRID:AB_1716735
- Product name
- UBD purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human UBD protein.
- Antigen sequence
MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKE
HVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDK
EKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQ
VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLE
DGKMMADYGIRKGNLLFLASYCIGG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Increased FAT10 expression is related to poor prognosis in pancreatic ductal adenocarcinoma.
Sun GH, Liu YD, Yu G, Li N, Sun X, Yang J
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2014 Jun;35(6):5167-71
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2014 Jun;35(6):5167-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UBD expression in transfected 293T cell line (H00010537-T02) by UBD MaxPab polyclonal antibody.Lane 1: UBD transfected lysate(18.15 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to UBD on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol