ABIN404988

KCNJ12 antibody from antibodies-online
hIRK1, IRK2, KCNJN1, Kir2.2, Kir2.2v

Antibody data

Product number
ABIN404988
Provider
antibodies-online
Product name
anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 12 (KCNJ12) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404988
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNJ12 antibody: synthetic peptide directed towards the middle region of human KCNJ12
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
KDLVENKFLLPSANSFCYENELAFLSRDEEDEADG
DQDGR SRDGLSPQAR
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -