HPA027021

KCNJ12 antibody from Sigma-Aldrich
hIRK1, IRK2, KCNJN1, Kir2.2, Kir2.2v
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027021
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027021, RRID:AB_10602912
Product name
Anti-KCNJ12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027021
Antibody type
Polyclonal
Antigen
potassium inwardly-rectifying channel, subfamily J, member 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RCSAKDLVENKFLLPSANSFCYENELAFLSRDEED
EADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQR
PYRRESEI
Storage
-20C
Provider Type Product Number
- No reagents -