HPA013180

NETO2 antibody from Sigma-Aldrich
FLJ10430, NEOT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013180
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013180, RRID:AB_1854383
Product name
Anti-NETO2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013180
Antibody type
Polyclonal
Antigen
Neuropilin and tolloid-like protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFE
CRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTG
RFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGG
ILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQA
VDCIWTIKA
Storage
-20C
Provider Type Product Number
- No reagents -