Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502473 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC46A1 antibody: synthetic peptide directed towards the N terminal of human SLC46A1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
- MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFA
 LVLQG PLTTQYLWHR
- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references		Heme carrier protein (HCP-1) spatially interacts with the CD163 hemoglobin uptake pathway and is a target of inflammatory macrophage activation.
				
		
	
			Schaer CA, Vallelian F, Imhof A, Schoedon G, Schaer DJ
Journal of leukocyte biology 2008 Feb;83(2):325-33
		Journal of leukocyte biology 2008 Feb;83(2):325-33
				No comments: Submit comment	
	
			
			No validations: Submit validation data