HPA052636

CAMLG antibody from Atlas Antibodies
CAML, GET2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052636
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052636, RRID:AB_2681893
Product name
Anti-CAMLG
Provider product page
Atlas Antibodies - HPA052636
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQ
RGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGN
TTEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -