SAB1400040

CAMLG antibody from Sigma-Aldrich
CAML, GET2
ELISA
Recommended by provider

Antibody data

Product number
SAB1400040
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400040, RRID:AB_1845960
Product name
Anti-CAMLG antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400040
Antibody type
Polyclonal
Antigen
CAMLG (NP_001736.1, a.a. 1-296) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MESMAVATDGGERPGVPAGSGLSASQRRAELRRRK
LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDS
DKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEV
KGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLT
ADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPS
QEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKY
LSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTA
ALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFT
FIFCHELLDYWGSEVP (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -