HPA011069

MANEA antibody from Atlas Antibodies
FLJ12838, mandaselin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011069
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011069, RRID:AB_888446
Product name
Anti-MANEA
Provider product page
Atlas Antibodies - HPA011069
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYN
LKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAF
YRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSG
SRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIY
T
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -