HPA011069

MANEA antibody from Sigma-Aldrich
FLJ12838, mandaselin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011069
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011069, RRID:AB_1079304
Product name
Anti-MANEA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011069
Antibody type
Polyclonal
Antigen
Glycoprotein endo-alpha-1,2-mannosidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYN
LKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAF
YRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSG
SRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIY
T
Storage
-20C
Provider Type Product Number
- No reagents -