Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 29560002 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#29560002, RRID:AB_2098644
- Product name
- Rabbit Polyclonal EPC1 Antibody
- Antibody type
- Polyclonal
- Description
- Immunogen affinity purified.
- Host
- Rabbit
- Antigen sequence
SECSVGNRAVTQMPSGMEKEEEQEKHLQEAIAAQQ
ASTSGIQLNHVIPTPKVDRVEDQRYHSTYHNKNKM
HRSKYIKVHAWQALERDEPEYDYDTEDEAW- Isotype
- IgG
- Vial size
- 0.05 mg
- Storage
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Submitted references Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections with Obesity.
High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays.
Garrison CB, Lastwika KJ, Zhang Y, Li CI, Lampe PD
Journal of proteome research 2017 Jan 6;16(1):274-287
Journal of proteome research 2017 Jan 6;16(1):274-287
High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays.
Rho JH, Lampe PD
Journal of proteome research 2013 May 3;12(5):2311-20
Journal of proteome research 2013 May 3;12(5):2311-20
No comments: Submit comment
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Western Blot: EPC1 Antibody [29560002] - This image is specific to animal number Q0820 Dilution: 1:10000
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Western Blot: EPC1 Antibody [29560002] - This image is specific to animal number Q0819 Dilution: 1:10000