H00025945-M01

NECTIN3 antibody from Abnova Corporation
CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRL3, PVRR3

Antibody data

Product number
H00025945-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025945-M01, RRID:AB_1579431
Product name
PVRL3 monoclonal antibody (M01), clone 1D1
Provider product page
Abnova Corporation - H00025945-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PVRL3.
Antigen sequence
PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEK
IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSL
NDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTT
VTV
Isotype
IgG
Antibody clone number
1D1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -