ABIN785184

NECTIN3 antibody from antibodies-online
CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRL3, PVRR3

Antibody data

Product number
ABIN785184
Provider
antibodies-online
Product name
anti-Poliovirus Receptor-Related 3 (PVRL3) (Middle Region) antibody
Provider product page
antibodies-online - ABIN785184
Antibody type
Polyclonal
Antigen
The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the middle region of human PVRL3
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENL
NRFER PMDYYEDLKM
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -