HPA011038

NECTIN3 antibody from Atlas Antibodies
CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRL3, PVRR3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011038
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011038, RRID:AB_1079719
Product name
Anti-NECTIN3
Provider product page
Atlas Antibodies - HPA011038
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSL
NDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTT
VTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATG
KPVAHIDWEGDLGEMESTTTSF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -