HPA011038

NECTIN3 antibody from MilliporeSigma / Merck KGaA
CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRL3, PVRR3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011038
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA011038, RRID:AB_1079719
Product name
Anti-PVRL3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA011038
Antibody type
Polyclonal
Antigen
Poliovirus receptor-related protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSL
NDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTT
VTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATG
KPVAHIDWEGDLGEMESTTTSF
Storage
-20C
Provider Type Product Number
- No reagents -