HPA011038

PVRL3 antibody from Sigma-Aldrich
CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRR3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011038
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011038, RRID:AB_1079719
Product name
Anti-PVRL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011038
Antibody type
Polyclonal
Antigen
Poliovirus receptor-related protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSL
NDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTT
VTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATG
KPVAHIDWEGDLGEMESTTTSF
Storage
-20C
Provider Type Product Number
- No reagents -