Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024764 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024764, RRID:AB_10603236
- Product name
- Anti-RSPO2
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGH
WSEWGTCSRNNRTCGFKWGLETRTRQI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references R-spondin2 signaling is required for oocyte-driven intercellular communication and follicular growth
Targeting the Wnt signaling pathway through R-spondin 3 identifies an anti-fibrosis treatment strategy for multiple organs
De Cian M, Gregoire E, Le Rolle M, Lachambre S, Mondin M, Bell S, Guigon C, Chassot A, Chaboissier M
Cell Death & Differentiation 2020;27(10):2856-2871
Cell Death & Differentiation 2020;27(10):2856-2871
Targeting the Wnt signaling pathway through R-spondin 3 identifies an anti-fibrosis treatment strategy for multiple organs
Mukhopadhyay P, Zhang M, Haughey M, Wang N, Blease K, Kapoun A, Couto S, Belka I, Hoey T, Groza M, Hartke J, Bennett B, Cain J, Gurney A, Benish B, Castiglioni P, Drew C, Lachowicz J, Carayannopoulos L, Nathan S, Distler J, Brenner D, Hariharan K, Cho H, Xie W
PLOS ONE 2020;15(3):e0229445
PLOS ONE 2020;15(3):e0229445
No comments: Submit comment
No validations: Submit validation data