Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015613 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA015613, RRID:AB_2732414
- Product name
- Anti-CDH4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YLIDINDNAPELLPKEAQICERPNLNAINITAADA
DVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQ
LSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKV
KVCPCD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Delineation of the Key Aspects in the Regulation of Epithelial Monolayer Formation
A protein interaction map for cell-cell adhesion regulators identifies DUSP23 as a novel phosphatase for β-catenin
Aschauer L, Gruber L, Pfaller W, Limonciel A, Athersuch T, Cavill R, Khan A, Gstraunthaler G, Grillari J, Grillari R, Hewitt P, Leonard M, Wilmes A, Jennings P
Molecular and Cellular Biology 2023;33(13):2535-2550
Molecular and Cellular Biology 2023;33(13):2535-2550
A protein interaction map for cell-cell adhesion regulators identifies DUSP23 as a novel phosphatase for β-catenin
Gallegos L, Ng M, Sowa M, Selfors L, White A, Zervantonakis I, Singh P, Dhakal S, Harper J, Brugge J
Scientific Reports 2016;6(1)
Scientific Reports 2016;6(1)
No comments: Submit comment
No validations: Submit validation data