HPA014044

CLEC4G antibody from Sigma-Aldrich
LSECtin, UNQ431
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014044
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014044, RRID:AB_1846916
Product name
Anti-CLEC4G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014044
Antibody type
Polyclonal
Antigen
C-type lectin domain family 4 member G recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGV
SLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPC
DSEKDGWICEKR
Storage
-20C
Provider Type Product Number
- No reagents -