Antibody data

Product number
H00007113-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007113-M05, RRID:AB_1137496
Product name
TMPRSS2 monoclonal antibody (M05), clone 2F4
Provider product page
Abnova Corporation - H00007113-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.
Antigen sequence
GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYD
NLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNI
WWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQ
MRADG
Isotype
IgG
Antibody clone number
2F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -