HPA013182

TMPRSS2 antibody from MilliporeSigma / Merck KGaA
PRSS10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013182
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013182, RRID:AB_1858150
Product name
Anti-TMPRSS2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013182
Antibody type
Polyclonal
Antigen
Transmembrane protease, serine 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKL
QKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGA
TEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLIT
PAMICAGFLQGNVDSCQGD
Storage
-20C
Provider Type Product Number
- No reagents -