Antibody data

Product number
H00023175-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023175-M03, RRID:AB_1204628
Product name
LPIN1 monoclonal antibody (M03), clone 3D9
Provider product page
Abnova Corporation - H00023175-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant LPIN1.
Antigen sequence
EPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGE
LVQEHAKTNISSYVRLCEVVDHVFPLLKRSHSSDF
PCSDTFSNFTFWREPLPPFENQDIHSASA
Isotype
IgG
Antibody clone number
3D9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -