HPA039485

FNBP4 antibody from Atlas Antibodies
KIAA1014

Antibody data

Product number
HPA039485
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039485, RRID:AB_2676536
Product name
Anti-FNBP4
Provider product page
Atlas Antibodies - HPA039485
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
STQTSGWQYDTQCSLAGVGIEMGDWQEVWDENTGC
YYYWNTQTNEVTWELPQYLATQVQGLQHYQPSSVP
GAETSFVVNT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.