Antibody data

Product number
HPA040029
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040029, RRID:AB_2676808
Product name
Anti-FNBP4
Provider product page
Atlas Antibodies - HPA040029
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NGETAIGAENSEKIDENSDKEMEVEESPEKIKVQT
TPKVEEEQDLKFQIGELANTLTSKFEFLGINRQSI
SNFHVLLLQTETRIAD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.