Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 18-272-196967 - Provider product page
- Provider
- GenWay
- Product name
- TLR5
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ, corresponding to amino acids 151-181 of Human TLR5.
- Description
- Immunogen affinity purified
- Reactivity
- Human
- Host
- Goat
- Isotype
- IgG
- Vial size
- 0.1 mg
- Storage
- Aliquot and store at -20 to -80 C
No comments: Submit comment
No validations: Submit validation data