18-272-196967

TLR5 antibody from GenWay
FLJ10052, MGC126430, MGC126431, SLEB1, TIL3
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
18-272-196967
Provider
GenWay
Product name
TLR5
Provider product page
GenWay - 18-272-196967
Antibody type
Polyclonal
Antigen
Synthetic peptide: DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ, corresponding to amino acids 151-181 of Human TLR5.
Description
Immunogen affinity purified
Reactivity
Human
Host
Goat
Isotype
IgG
Vial size
0.1 mg
Storage
Aliquot and store at -20 to -80 C
Provider Type Product Number
- No reagents -