PAB14602
antibody from Abnova Corporation
Targeting: TLR5
FLJ10052, MGC126430, MGC126431, SLEB1, TIL3
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB14602 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB14602, RRID:AB_10675145
- Product name
- TLR5 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide corresponding to amino acids 151-181 of human TLR5.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
CDLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ
- Vial size
- 100 µl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of hTLR10: a novel human Toll-like receptor preferentially expressed in immune cells.
The human toll signaling pathway: divergence of nuclear factor kappaB and JNK/SAPK activation upstream of tumor necrosis factor receptor-associated factor 6 (TRAF6).
Innate immunity: the virtues of a nonclonal system of recognition.
Chuang T, Ulevitch RJ
Biochimica et biophysica acta 2001 Mar 19;1518(1-2):157-61
Biochimica et biophysica acta 2001 Mar 19;1518(1-2):157-61
The human toll signaling pathway: divergence of nuclear factor kappaB and JNK/SAPK activation upstream of tumor necrosis factor receptor-associated factor 6 (TRAF6).
Muzio M, Natoli G, Saccani S, Levrero M, Mantovani A
The Journal of experimental medicine 1998 Jun 15;187(12):2097-101
The Journal of experimental medicine 1998 Jun 15;187(12):2097-101
Innate immunity: the virtues of a nonclonal system of recognition.
Medzhitov R, Janeway CA Jr
Cell 1997 Oct 31;91(3):295-8
Cell 1997 Oct 31;91(3):295-8
No comments: Submit comment
No validations: Submit validation data