ABIN147183
antibody from antibodies-online
Targeting: TLR5
FLJ10052, MGC126430, MGC126431, SLEB1, TIL3
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN147183 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Toll-Like Receptor 5 (TLR5) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ, corresponding to amino acids 151-181 of Human TLR5.
- Description
- Immunogen affinity purified
- Reactivity
- Human
- Host
- Goat
- Isotype
- IgG
- Vial size
- 0.1 mg
- Concentration
- 2 mg/ml
- Storage
- -20°C
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry