Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007729 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007729, RRID:AB_1852906
- Product name
- Anti-LTA
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGF
SLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSS
PLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEP
WLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Genetic variation on the BAT1-NFKBIL1-LTA region of major histocompatibility complex class III associates with periodontitis.
Kallio KA, Marchesani M, Vlachopoulou E, Mäntylä P, Paju S, Buhlin K, Suominen AL, Contreras J, Knuuttila M, Hernandez M, Huumonen S, Nieminen MS, Perola M, Sinisalo J, Lokki ML, Pussinen PJ
Infection and immunity 2014 May;82(5):1939-48
Infection and immunity 2014 May;82(5):1939-48
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and lTA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424627).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN