HPA007729

LTA antibody from Sigma-Aldrich
LT, TNFB, TNFSF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007729
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007729, RRID:AB_1852906
Product name
Anti-LTA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007729
Antibody type
Polyclonal
Antigen
LTA protein Lymphotoxin alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGF
SLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSS
PLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEP
WLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSP
Storage
-20C
Provider Type Product Number
- No reagents -