HPA017655

ENTPD4 antibody from Sigma-Aldrich
KIAA0392, LALP70, LAP70, LYSAL1, NTPDase-4, UDPase
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017655
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017655, RRID:AB_1848181
Product name
Anti-ENTPD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017655
Antibody type
Polyclonal
Antigen
Ectonucleoside triphosphate diphosphohydrolase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FGGNAARQRYEDRIFANTIQKNRLLGKQTGLTPDM
PYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRE
TIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFS
EFYYCTEDVLR
Storage
-20C
Provider Type Product Number
- No reagents -