HPA022470

PRUNE2 antibody from Atlas Antibodies
A214N16.3, bA214N16.3, BMCC1, BNIPXL, C9orf65, KIAA0367
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022470
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022470, RRID:AB_1845832
Product name
Anti-PRUNE2
Provider product page
Atlas Antibodies - HPA022470
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LNDEGKLSITLVGSSVLASEDKTLESAVVKVINPV
EQSDANVEFRESSSSLVLKEILQEAPELITEQLAH
RLRGSILFKWMT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -