PAB22505
antibody from Abnova Corporation
Targeting: PRUNE2
A214N16.3, bA214N16.3, BMCC1, BNIPXL, C9orf65, KIAA0367
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22505 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22505, RRID:AB_10983734
- Product name
- PRUNE2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant PRUNE2.
- Antigen sequence
MESEKISEKQEEILSILEEKFPNLPPREDIINVLQ
ETQFSAQGLSIEQTMLKDLKELSDGEIKVAISTVS
MNLEVRVGML- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PRUNE2 polyclonal antibody (Cat # PAB22505) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus & vesicles.Using PRUNE2 polyclonal antibody (Cat # PAB22505).
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum with PRUNE2 polyclonal antibody (Cat # PAB22505) shows strong nucleolar positivity in glandular cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)