HPA031079

PRUNE2 antibody from MilliporeSigma / Merck KGaA
A214N16.3, bA214N16.3, BMCC1, BNIPXL, C9orf65, KIAA0367
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031079
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031079, RRID:AB_10603230
Product name
Anti-PRUNE2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031079
Antibody type
Polyclonal
Antigen
prune homolog 2 (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MESEKISEKQEEILSILEEKFPNLPPREDIINVLQ
ETQFSAQGLSIEQTMLKDLKELSDGEIKVAISTVS
MNLEVRVGML
Storage
-20C
Provider Type Product Number
- No reagents -