Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503120 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Spermatogenesis Associated 9 (SPATA9) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPATA9 antibody: synthetic peptide directed towards the N terminal of human SPATA9
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFK
DEFPT ILRLSQSNQK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human testicular protein NYD-SP16 is involved in sperm capacitation and the acrosome reaction.
Tailored prophylaxis in severe hemophilia A: interim results from the first 5 years of the Canadian Hemophilia Primary Prophylaxis Study.
Lu Y, Huo R, Yuan Y, Li J, Shi Q, Sha J
Fertility and sterility 2006 Oct;86(4 Suppl):1228-34
Fertility and sterility 2006 Oct;86(4 Suppl):1228-34
Tailored prophylaxis in severe hemophilia A: interim results from the first 5 years of the Canadian Hemophilia Primary Prophylaxis Study.
Feldman BM, Pai M, Rivard GE, Israels S, Poon MC, Demers C, Robinson S, Luke KH, Wu JK, Gill K, Lillicrap D, Babyn P, McLimont M, Blanchette VS, Association of Hemophilia Clinic Directors of Canada Prophylaxis Study Group
Journal of thrombosis and haemostasis : JTH 2006 Jun;4(6):1228-36
Journal of thrombosis and haemostasis : JTH 2006 Jun;4(6):1228-36
No comments: Submit comment
No validations: Submit validation data