HPA010848

SPATA9 antibody from Sigma-Aldrich
FLJ35906, NYD-SP16
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010848
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010848, RRID:AB_1857422
Product name
Anti-SPATA9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010848
Antibody type
Polyclonal
Antigen
Spermatogenesis-associated protein 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKKVKNIFQEEESIRQNREESENCRKAFSEPVLSE
PMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSN
NIQVLHSVFDQSAEMNEQI
Storage
-20C
Provider Type Product Number
- No reagents -