Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051527-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051527-M06, RRID:AB_10616183
- Product name
- C14orf129 monoclonal antibody (M06), clone 2F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant C14orf129.
- Antigen sequence
METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRL
EAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVET
KERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHE
TVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS- Isotype
- IgG
- Antibody clone number
- 2F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of C14orf129 expression in transfected 293T cell line by C14orf129 monoclonal antibody (M06), clone 2F2.Lane 1: C14orf129 transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged C14orf129 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to C14orf129 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol