HPA017322

FAR1 antibody from Sigma-Aldrich
FLJ22728, MLSTD2, SDR10E1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017322
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017322, RRID:AB_1848424
Product name
Anti-FAR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017322
Antibody type
Polyclonal
Antigen
Fatty acyl-CoA reductase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVY
VLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFR
EKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHC
AATVRFNENLRDAVQLNVIATRQLILLAQQMKNLE
VFM
Storage
-20C
Provider Type Product Number
- No reagents -