HPA017322

FAR1 antibody from Atlas Antibodies
FLJ22728, MLSTD2, SDR10E1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017322
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017322, RRID:AB_1848424
Product name
Anti-FAR1
Provider product page
Atlas Antibodies - HPA017322
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVY
VLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFR
EKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHC
AATVRFNENLRDAVQLNVIATRQLILLAQQMKNLE
VFM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -