Antibody data

Product number
H00257019-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00257019-M09, RRID:AB_1237712
Product name
FRMD3 monoclonal antibody (M09), clone 2F1
Provider product page
Abnova Corporation - H00257019-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FRMD3.
Antigen sequence
SAPLISSSPVKAAREYEDPPSEEEDKIKEEPLTIS
ELVYNPSASLLPTPVDDDEIDMLFDCPSRLELERE
DTDSFEDLEADENAFLIA
Isotype
IgG
Antibody clone number
2F1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -