Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA053879 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA053879, RRID:AB_2682289
- Product name
- Anti-DLK1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAV
NIIFPEKIDMTTFSKEA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The Use of Silk as a Scaffold for Mature, Sustainable Unilocular Adipose 3D Tissue Engineered Systems
Abbott R, Wang R, Reagan M, Chen Y, Borowsky F, Zieba A, Marra K, Rubin J, Ghobrial I, Kaplan D
Advanced Healthcare Materials 2016;5(13):1667-1677
Advanced Healthcare Materials 2016;5(13):1667-1677
No comments: Submit comment
No validations: Submit validation data