HPA010600

PSTPIP1 antibody from Atlas Antibodies
CD2BP1, CD2BP1L, CD2BP1S, H-PIP, PAPAS, PSTPIP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010600
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010600, RRID:AB_1235375
Product name
Anti-PSTPIP1
Provider product page
Atlas Antibodies - HPA010600
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GMIKRFSGLLHGSPKTTSLAASAASTETLTPTPER
NEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNP
DELDLSAGDILEVILEGEDGWWTVERNGQRGFVPG
SYLEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -