HPA010600

PSTPIP1 antibody from Atlas Antibodies
CD2BP1, CD2BP1L, CD2BP1S, H-PIP, PAPAS, PSTPIP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010600
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010600, RRID:AB_1855870
Product name
Anti-PSTPIP1
Provider product page
Atlas Antibodies - HPA010600
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GMIKRFSGLLHGSPKTTSLAASAASTETLTPTPER
NEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNP
DELDLSAGDILEVILEGEDGWWTVERNGQRGFVPG
SYLEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -