HPA011134

TIAM2 antibody from Sigma-Aldrich
STEF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011134
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011134, RRID:AB_1858005
Product name
Anti-TIAM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011134
Antibody type
Polyclonal
Antigen
T-lymphoma invasion and metastasis-inducing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEGLRKGNEIMTLNGEAVSDLDLKQMEALFSEKSV
GLTLIARPPDTKATLCTSWSDSDLFSRDQKSLLPP
PNQSQLLEEFLDNFKKNTANDFSNVPDITTGLKRS
QTDGTLDQVSHR
Storage
-20C
Provider Type Product Number
- No reagents -