Antibody data

Product number
H00010015-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010015-M01, RRID:AB_436987
Product name
PDCD6IP monoclonal antibody (M01), clone 3C4
Provider product page
Abnova Corporation - H00010015-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PDCD6IP.
Antigen sequence
MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEE
QAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR
YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLF
GGSVK
Isotype
IgG
Antibody clone number
3C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -