HPA011905

PDCD6IP antibody from Sigma-Aldrich
AIP1, Alix, Hp95
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011905
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011905, RRID:AB_1855111
Product name
Anti-PDCD6IP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011905
Antibody type
Polyclonal
Antigen
Programmed cell death 6-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLAN
GVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQG
GIQTVDQLIKELPELLQRNREILDESLRLLDEEEA
TDND
Storage
-20C
Provider Type Product Number
- No reagents -